PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D01G2011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 422aa    MW: 45967.5 Da    PI: 8.9229
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D01G2011genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1482.7e-15337385553
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN+ Lk+ l el+
  Gh_D01G2011 337 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKQENTHLKQALVELE 385
                  79****************************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-12333394IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.519335387IPR004827Basic-leucine zipper domain
PfamPF001707.4E-12337389IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.2E-14337390No hitNo description
CDDcd147071.37E-23337391No hitNo description
SuperFamilySSF579593.75E-10337386No hitNo description
PROSITE patternPS000360340355IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MVVEDSEVGE VESTLKEVDQ QLKNHPLSAL GRQSSIYSLT LDEFQHTLCG KNFGSMNMDE  60
FLTSIWNAEE NQATNSINNN HHNNGVNEQV SNHVNLSLNE TASSKGVARQ SSLPRQGSLS  120
LPAPLCRKTV DEVWSEIHKV QQGQGQSNNS NVQNAENTST RQPTFGEMTL EDFLVKAGVV  180
REPCVPPAVP PHSQHQQQFG LHQASNNPAV GPSFVPRPIM GMGGSGGFGG STYQTMPPSG  240
VLGDSSRYLN DGKGGGGYQP AAAPPSTAIC YNGKVGAAGG FGPGQAMGVV SPISPVSPDG  300
ICTNQVDNAA TQFGIEIGGL RGRKRIIDGP IEKVVERRQR RMIKNRESAA RSRARKQAYT  360
VELEAELNQL KQENTHLKQA LVELERKRKQ QYFEEWSMKT QTKAQKAKEK LRVMRRNLSG  420
PL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468185.10.0PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X2
SwissprotQ9SJN01e-126ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLA0A0D2QI930.0A0A0D2QI93_G
STRINGVIT_08s0007g03420.t011e-145(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM92012536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.11e-109bZIP family protein